PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi07g24170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family SBP
Protein Properties Length: 932aa    MW: 103273 Da    PI: 7.9765
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi07g24170.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.31.4e-4085162178
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +Cqv++C+adl +ak+yhrrhkvC+vhska+v+lv +++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  Vradi07g24170.1  85 VCQVQDCTADLGNAKDYHRRHKVCDVHSKATVALVGDVMQRFCQQCSRFHVLQEFDEGKRSCRRRLAGHNRRRRKTHP 162
                      6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.0E-3179147IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.62483160IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.09E-3784165IPR004333Transcription factor, SBP-box
PfamPF031104.6E-2986159IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.25.40.201.7E-7201226IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484031.66E-7662818IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.7E-7707817IPR020683Ankyrin repeat-containing domain
CDDcd002044.51E-7708817No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 932 aa     Download sequence    Send to blast
MCFFRWVCKL DVVAKREGKK ELEKRRRRVI GEGEGEGMND EGGSLSLNLG GHGYPFMVEG  60
EEKGGKKTKV IGTTTASATT SNRAVCQVQD CTADLGNAKD YHRRHKVCDV HSKATVALVG  120
DVMQRFCQQC SRFHVLQEFD EGKRSCRRRL AGHNRRRRKT HPDVTVVNEG SHNSGRGSSY  180
LLMSLLRILT NLHTNGSDHT RNQDILSHLL RNLASLAAPN NDRTLASLLE NSKGLLNDGT  240
SGGAHDEPNL HSNTPEASRP SGSSLQIDNG FISQDPPISM AQCETRPTNG GVENLRPPSG  300
APFSSISQSK GNLPCQLTAT ETTLRRNNLN NVDLNNVYSD VQNTDENHKK PYPHVASEVG  360
SSDLPSWLQC ASLKSSGEAK SCTDRIVFKL FGKNPSNFPL LLRSQILNWL SHSPTEIESY  420
IRPGCIILTI YLCLEKSAWE ELCCNLGSSL RKLLSSSNDT FWRTGWVFAR VQHSVAFLYN  480
GQVVLDVPLC LKSSHHCTIS CIKPLAVPAS ARAHFIVKGC NLSQSSTRLL CALEGKYVVH  540
ASCHDLIGED EESIQHLNFS CHIPDVTGRG FIEVEDHCLR SCSFPFIVAE KEVCSEICKL  600
ENVIEAAETT NDFQIKNQQM EEKAQALNFL QEMGWLLHRS RMKVRLGPMA PIHDLFQFNR  660
FTWLVDFSMD HGWCAVMKKL LDIIFDGGVD TGEQASIELA LLDLSLLHKA VKRNNRPMVE  720
LLLRFVPVKT SDGADSEVKQ VEKASDRFLF RPDTVGPAGL TPLHVAATMR GSENVLDALT  780
DDPGMVGIEV WKSARDSAGL TPNDYACLRG YYSYVQLVER KTKKKGERLH VVDIPGTVAD  840
SGIRKQKQSG KVSSLQTEKI ETTEMGSNCR VCQQKLVYGG IRTGVVYRPV LLSMVAIAAV  900
CVCVALLFKS SPRVYYVFQP FNWESLEYGT I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-3176159184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12328KRRRRV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014506940.10.0PREDICTED: squamosa promoter-binding-like protein 1
TrEMBLA0A0L9TS570.0A0A0L9TS57_PHAAN; Uncharacterized protein
TrEMBLA0A0S3R9840.0A0A0S3R984_PHAAN; Uncharacterized protein
STRINGGLYMA07G36180.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15393495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1